SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D7PVF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7PVF8
Domain Number 1 Region: 186-303
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.62e-21
Family YiiX-like 0.079
Further Details:      
 
Weak hits

Sequence:  D7PVF8
Domain Number - Region: 89-158
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00942
Family Capz alpha-1 subunit 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7PVF8
Sequence length 310
Comment (tr|D7PVF8|D7PVF8_LACBR) Uncharacterized protein {ECO:0000313|EMBL:ADH51643.1} OX=1580 OS=Lactobacillus brevis. GN= OC=Lactobacillus.
Sequence
MNKLIRYALIGLIAAGGGIFLGQEPAQASYNTMFAREGYFSTHEKVDATSFFDRKISTYK
SVYITQTKHGAVRNASLMFYSKPQTSKFDGYAKHWINVRQLKNGKVYAYNEKTVYGNYLV
SYHQLSKGHGSNIKAGSRKVNVHFSKAGNVLFKYQKNLLTVHLKNGRITLNGKATQARNN
RVFKRAVPKHGTRVNRLVADAKRYLSVPYRYAGRDAFGGLDCASFVDQVYLDVEHRDIGG
MTGVQQTLGKHVAVSKAKKGDLLFWQVAGQKYTYHVAMAIGHGKLIEEAGKSVHVSKISH
RHPQFAIHME
Download sequence
Identical sequences D7PVF8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]