SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7RPM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7RPM0
Domain Number 1 Region: 63-119
Classification Level Classification E-value
Superfamily Nucleocapsid protein dimerization domain 9.15e-28
Family Arterivirus nucleocapsid protein 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7RPM0
Sequence length 128
Comment (tr|D7RPM0|D7RPM0_PRRSV) Nucleocapsid protein {ECO:0000313|EMBL:ADI60328.1} OX=28344 OS=Porcine reproductive and respiratory syndrome virus (PRRSV). GN= OC=Nidovirales; Arteriviridae; unclassified Arteriviridae. OH=9823
Sequence
MAGKNQSQKKKKNTAPMGNGQPVNQLCQLLGAMIKSQRQQPRGGQAKKRKPEKPHFPLAA
EDDIRHHLTQTERSLCLQSIQTAFNQGAGTASLSSSGKVSFQVEFMLPVAHTVRLIRVTS
TSASQGAS
Download sequence
Identical sequences D7RPM0
D7RPM0_PRRSV

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]