SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7SKA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7SKA9
Domain Number 1 Region: 336-393
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 9.68e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00077
Further Details:      
 
Domain Number 2 Region: 5-48
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000445
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D7SKA9
Sequence length 393
Comment (tr|D7SKA9|D7SKA9_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CBI16085.3} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VIT_06s0004g05210 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MAISSMTSTVYVSVIEDVINKVRDEFVNNGGPGESVLSELQGIWEMKMVQAGVVTGPIER
STAPKQTSGAPAPTPPVHDLNVPYEGTEEYETPTAEILFPPTPLQTPIQTPLPGMGDNSM
YNIPTGPTEYPAAQDGGGATDMKSGRPPSYMPPPSPWMQQRPPLSVDVNVAYVEGRDEGD
RGNSQQPLTQDFFMMSSGKRKREDFPSQYHTSGYIPQQDGAGDPAPEVFEVEVSQGSNSI
KGHDILTKANREIFPQVAGSYVRIPQLDGPIPDPYEDVLSTPNIYNYQGVVNEDYNIVNT
PAPNDIQAGTPAVGIQNDVGDDDDDEPPLNENDDDDLDDVEQGEELNTQHLVLAQFDKVT
RTKSKWKCTLKDGIMHINNKDILFNKANGEFDF
Download sequence
Identical sequences D7SKA9
GSVIVT01024907001 XP_002282322.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]