SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7TYG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7TYG4
Domain Number 1 Region: 150-192
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0000612
Family Leucine zipper domain 0.0042
Further Details:      
 
Weak hits

Sequence:  D7TYG4
Domain Number - Region: 197-246
Classification Level Classification E-value
Superfamily TAFH domain-like 0.0392
Family TAFH domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D7TYG4
Sequence length 272
Comment (tr|D7TYG4|D7TYG4_VITVI) Uncharacterized protein {ECO:0000313|EMBL:CBI35539.3} KW=Complete proteome; Reference proteome OX=29760 OS=Vitis vinifera (Grape). GN=VIT_18s0001g03010 OC=Pentapetalae; rosids; Vitales; Vitaceae; Vitis.
Sequence
MQRGHRRSASDSLAYLGAVAKVSNTNEDHKFKNSFAWPSFGSLCNASTYTRPSSFDENQN
RAWESSLNCLNYTSDLPLTRDQPNIINVQVSGSCAPPDQPDGVPPIATKKQDCAESISHN
QEDSSERSDSSSAQPSLSKNDAKRAKQQFAQRSRLRKLQYIAELEMSVQVLQAEGCEISA
AVEYLDQHNLILGMKNRALQQRLESSSQEYLIKQLEQDMLEREIRRLQILYQQQQQQQQQ
QQQQQQQQQFSGHRRAKSRNLDSPFSNTSVKT
Download sequence
Identical sequences D7TYG4
GSVIVT01001783001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]