SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8RVL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8RVL2
Domain Number 1 Region: 1-243
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-72
Family Capz beta-1 subunit 0.000000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D8RVL2
Sequence length 269
Comment (tr|D8RVL2|D8RVL2_SELML) Uncharacterized protein {ECO:0000313|EMBL:EFJ23979.1} KW=Complete proteome; Reference proteome OX=88036 OS=Selaginella moellendorffii (Spikemoss). GN=SELMODRAFT_102808 OC=Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
Sequence
MDAAMDLIRRMPPAEVEMALASLLVLLPDHSADLLSKVDQPLQEAWDDESGRQYLLCDYN
RDGDSYRSPWSNKYDPPLEDGAMPSEKLRELEVEANEVFAIYRDQYYEGGTSSVYMWETE
ENGGFAACFLVKKEGRRGLLDHGLWDAIHIIEVVSEEEGEAHYCLTSTVMLSFTTKDDPS
MSFGLSGSIVRQMEADFPSTEGHLGNMGRMIEDMESKLRNGLDQVYFGKTKEVVFTMREP
LEILTATSATGQSLQQAVVGDIVRRRSVH
Download sequence
Identical sequences D8RVL2
XP_002975194.1.77236 XP_002977598.1.77236 jgi|Selmo1|102808|e_gw1.26.31.1 jgi|Selmo1|106718|e_gw1.34.29.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]