SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D8SH67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D8SH67
Domain Number 1 Region: 5-282
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.97e-70
Family Capz alpha-1 subunit 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D8SH67
Sequence length 291
Comment (tr|D8SH67|D8SH67_SELML) Uncharacterized protein {ECO:0000313|EMBL:EFJ16467.1} KW=Complete proteome; Reference proteome OX=88036 OS=Selaginella moellendorffii (Spikemoss). GN=SELMODRAFT_155274 OC=Lycopodiopsida; Selaginellales; Selaginellaceae; Selaginella.
Sequence
MDGATDDHKAGIAKWFLLRSPPGQIQQVAKDVQKILMSDKLYQQAASEAFPIYNMEQMIC
LELPDGSGQVLVSNCGALDSTHYLDLRTAQVATICTKIRPATDEELPSGFVEEYRSAIDS
ELLKYVEEAFPRGSCAVFCTAGSTAEEDDAPFELTALISASKISHQNFSSGSWRSTWKIQ
VNQELQSVDLTGKVHVNAHYFEEGNVQLDTNYEGSDSTVLQNPLDVATAVVNIIRSKESE
YLLSLEESYSKLSDNTFKELRRKLPVTRTLFAWNNALQLSLSREVTRELSK
Download sequence
Identical sequences D8SH67
jgi|Selmo1|155274|estExt_Genewise1.C_540417 XP_002982714.1.77236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]