SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D9STC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D9STC7
Domain Number 1 Region: 53-121,217-259
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000521
Family ABC transporter ATPase domain-like 0.062
Further Details:      
 
Weak hits

Sequence:  D9STC7
Domain Number - Region: 90-189
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0366
Family Capz alpha-1 subunit 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D9STC7
Sequence length 1037
Comment (tr|D9STC7|D9STC7_CLOC7) Uncharacterized protein {ECO:0000313|EMBL:ADL50743.1} KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=Clocel_0977 OC=Clostridium.
Sequence
MDMIGSGKLSIDNLPKERRAILAGIEAQIQKFRGNAEREEKECASKDKIRDKERPNNVIS
ILGGRGSGKTSVALTIYNSLRNNNSEKNLDSILNIIDPSKFNVEDNALGWIIYSFENDIE
KWKKDNSQNINYCNDIKNDGLYTKYEELKTNYIHSRKFYRENLSAITESRYEYDKINEKI
SSADRNLEKSFREFIEELCNVKRGSCKSSDDSGINEPMIFITFDDVDLCPEKGPEILELI
LNYLSHPNIVCIVLGDYATFSESLIIDLWKKSNIPSQLEKDTKANNNNTIFNNIVRRADD
ILGKVLPYKYRFELKDLELMDRLHFTPFGKGKMPKLYELIDKILIIEVNKGKSDEQTTGE
YEKSSLLKYFIEPLIDVSSIVKKIEELNLDKNETRRPYDGYHLDVADNNSYNELILKLQN
SSEHRKDLKELKAFDYAYILSGNPRGLINLYYKLEEICDGLDKPKLQVVSSTSSKFFGYG
DYQEIYLNNYNMYTKLFEAFYNSNIELVNNNDGFDIRDILKLNKNHSTLEINGNRLILTG
SDYYEYFNFNVSTSLLTISALKENRKMEKLNKDKCAFIQLFYDLAKVFLGSKIKEDEKTW
SFKNICIYKRSEDYISYNSIDFKYFYDFYYFQRLYKVCLPLIIRDRKVHADIRNRLKAVA
LSIIKAISADEVKEKSRFIEGIFNINKLDYYLISDIRDKLNTINTIAENYSERGIGIFFD
HENTDNIVHEILESQEQEYYRVRGLEEILKTSRYHLVCNEILTASDNSKKSVSQRCREIK
DIVNSLRNDEVFGDGTFNEILTYAESEDWQNMRKELVKINTIIAEYLTYKIQTSGNSITS
EKAVELIQSIKEVNQKFYNRINKNKSVEPVIGLAEYTELQDKLNSVINNSEIPLISNDSL
SESRILEPIIVNKKSKLSEQFILKPVIVNRNKKSKLDEPGKIEFMVSEFLRRSVIREPFK
ENAIGVLKQVTSDEEVVNICKDIDKNNFKEKMYGISKILIGRWYRIGNMDKINLLKEVAT
PDNEEFISTYENELLVL
Download sequence
Identical sequences D9STC7
gi|302873874|ref|YP_003842507.1| WP_010076410.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]