SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E1R6V6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E1R6V6
Domain Number - Region: 31-96
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0523
Family Capz alpha-1 subunit 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1R6V6
Sequence length 205
Comment (tr|E1R6V6|E1R6V6_SEDSS) Uncharacterized protein {ECO:0000313|EMBL:ADK81283.1} KW=Complete proteome; Reference proteome OX=573413 OS=4228) (Spirochaeta smaragdinae). GN=Spirs_2163 OC=Sediminispirochaeta.
Sequence
MNLRKNYLSLYNSFEKCTFLLNKNESCNNRFEIDGIINYFWQAWNSYWRSYWISKYTGYF
DVNNSYQHRNSILNTKNEKEIVYNILYKINKRKNPYGAISASFQEPTWGSFDSILNIAIA
LHEVKISSLVGSYSNSIKHLQITRNCTIHLNRATMNDMYKKVIPYYSIAKIKWPTDILFS
TPLYSRVKTYNKWSNDLLGFLENIM
Download sequence
Identical sequences E1R6V6
gi|302338671|ref|YP_003803877.1| WP_013254747.1.2896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]