SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E1W524 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E1W524
Domain Number 1 Region: 28-133
Classification Level Classification E-value
Superfamily DNA polymerase III psi subunit 7.45e-22
Family DNA polymerase III psi subunit 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E1W524
Sequence length 134
Comment (tr|E1W524|E1W524_HAEP3) DNA polymerase III subunit psi {ECO:0000256|PIRNR:PIRNR029225} KW=Complete proteome; Reference proteome OX=862965 OS=Haemophilus parainfluenzae (strain T3T1). GN=PARA_13650 OC=Pasteurellaceae; Haemophilus.
Sequence
MDRRNLLLNEMGITRWQLYRPEVLQGAVGVSVSEQVKFIVVVNDNLSSSPLFADIRLALE
LKKEDCLCLNFDQIQHITLQHSVRYWLLAENADEIDRTLPYCLNAERVYRSVDWQQFQQD
SQAKRELWQQIQQI
Download sequence
Identical sequences E1W524
WP_014065129.1.68312 WP_014065129.1.88531 gi|345429935|ref|YP_004823054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]