SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2ATD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2ATD4
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000000000129
Family Preprotein translocase SecE subunit 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2ATD4
Sequence length 66
Comment (tr|E2ATD4|E2ATD4_CAMFO) Protein transport protein Sec61 subunit gamma {ECO:0000313|EMBL:EFN63301.1} KW=Complete proteome; Reference proteome OX=104421 OS=Camponotus floridanus (Florida carpenter ant). GN=EAG_03148 OC=Vespoidea; Formicidae; Formicinae; Camponotus.
Sequence
MDQIKKLTEPGRQFAKDSIRLVKRCTKPDRKEFQKIAIATAIGFCIMGFIGFFVKLIHIP
INNIIV
Download sequence
Identical sequences A0A026WY22 A0A151JR79 A0A151X6H9 A0A195BLF5 A0A195CM04 E2ATD4 F4WIF9
Cflo_05051--XP_001120892.1_APIME Aech_04427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]