SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E2B5B7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2B5B7
Domain Number 1 Region: 10-284
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-108
Family Capz alpha-1 subunit 0.0000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2B5B7
Sequence length 289
Comment (tr|E2B5B7|E2B5B7_HARSA) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EFN89112.1} KW=Complete proteome; Reference proteome OX=610380 OS=Harpegnathos saltator (Jerdon's jumping ant). GN=EAI_05676 OC=Vespoidea; Formicidae; Ponerinae; Ponerini; Harpegnathos.
Sequence
MAADGDAVIPDQEKVRIVSDFILHSPPGEFNEVFNDVRVLLNNDNLLKEGASGAFAQYNK
DQLTPVKIEGSDHTALITEHNDLGSQRFYDARSKQSFKYDHLRKEAQDYEPYEPDPVAEA
WRSALQEEITNYTQSHYRHGACSVFGKSLGGNITLTACIEDHQFQPKNFWNGRWRSVWTV
SFTPNSGNAELRGSLKVQVHYYEDGNVQLVSSKEVKESLPISNEKQTAKDLIRFVEDSEN
DYQTAISENYQTMSDTTFKALRRQLPVMRTKIDWNKIVSYSIGKELKSQ
Download sequence
Identical sequences E2B5B7
XP_011145963.1.56509 Hsal_13022--XP_624862.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]