SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2DNW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2DNW2
Domain Number 1 Region: 39-104
Classification Level Classification E-value
Superfamily Nucleocapsid protein dimerization domain 6.32e-26
Family Coronavirus nucleocapsid protein 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2DNW2
Sequence length 107
Comment (tr|E2DNW2|E2DNW2_CVHNL) Nucleocapsid protein {ECO:0000313|EMBL:ADK37680.1} OX=277944 OS=Human coronavirus NL63 (HCoV-NL63). GN= OC=Nidovirales; Coronaviridae; Coronavirinae; Alphacoronavirus. OH=9606
Sequence
VTLALKNLGFDNQSKSPSSSGTSTPKKPNKPLSQPRADKPSQLKKPRWKRVPTREENVIQ
CFGPRDFNHNMGDSDLVQNGVDAKGFPQLAELIPNQAALFFDSENRR
Download sequence
Identical sequences E2DNW0 E2DNW2 E2DNW5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]