SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E2M5M0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2M5M0
Domain Number 1 Region: 14-74
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-17
Family Capz alpha-1 subunit 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2M5M0
Sequence length 74
Comment (tr|E2M5M0|E2M5M0_MONPE) Uncharacterized protein {ECO:0000313|EMBL:EEB87031.1} KW=Complete proteome; Reference proteome OX=554373 OS=(Witches'-broom disease fungus) (Marasmius perniciosus). GN=MPER_15808 OC=Moniliophthora.
Sequence
VQLSTTHTISIPLTSAIVTSAPNNAAPKILALIESEEGKYQTSLNDTYHEMSEKTFKSLR
RALPMTRQKLDWDK
Download sequence
Identical sequences E2M5M0
gi|215437042|gb|EEB87031.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]