SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3NTI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3NTI8
Domain Number 1 Region: 24-198
Classification Level Classification E-value
Superfamily STAT 5.1e-37
Family STAT 0.0012
Further Details:      
 
Domain Number 2 Region: 191-255
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.000000000124
Family STAT DNA-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E3NTI8
Sequence length 261
Comment (tr|E3NTI8|E3NTI8_CAERE) Uncharacterized protein {ECO:0000313|EMBL:EFO92119.1} KW=Complete proteome; Reference proteome OX=31234 OS=Caenorhabditis remanei (Caenorhabditis vulgaris). GN=CRE_11616 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MMGPSTQELQAALTDTSKACHHLWEENKDLQGRFVNELGELQRLQVAIQQLEQNQRAEQA
FAAKQSMAEMQKRATTLYELLGQKRSEIVQKLHDGTNIATGLQTQLITDKLFNWKNAQKL
AQIGVPFDERDSFLDEIQMEFEFLAEHNWQLNMFACWMCDLLRRAPQLNDGLAQSTIGKL
TVISEQMNKLLFMLVSQSFIVSVQPEPVLKTQHKFVTEVRLLIGDKLGIRQQLSNTNVSV
KIIAEDEAKQMSADYDSHKEM
Download sequence
Identical sequences E3NTI8
CRE11616 XP_003088283.1.11157 31234.CRE11616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]