SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E3QH72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3QH72
Domain Number 1 Region: 3-263
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.67e-87
Family Capz alpha-1 subunit 0.00000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E3QH72
Sequence length 271
Comment (tr|E3QH72|E3QH72_COLGM) F-actin capping protein alpha subunit {ECO:0000313|EMBL:EFQ30234.1} KW=Complete proteome; Reference proteome OX=645133 OS=anthracnose fungus) (Glomerella graminicola). GN=GLRG_05378 OC=Colletotrichum.
Sequence
MSQVETVSSFVEGAPPGELADVIADIKSLTVSDPDIVSSLEPAFEKYNEEQFATVKLPGG
SQQVIISSYSSLGDGQYFDVESSTSFSFDHSTQKASNVQSYVLDSANADLIKSTLKSLGP
YVQEHFPNAAYGVYPTANDTQVAVIVVSNKYSPNNFWNGRWRSLYIFDPSSSSLEGSVKV
DVHYYEDGNVRLLTNRPSQASVSSGTGAGIVKEISTSEKKYQEELNRGFTSLSEGAFKGL
RRQLPVTRQKIEWDKITSYRLGQDIGGGARR
Download sequence
Identical sequences E3QH72
XP_008094254.1.39555 EFQ30234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]