SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E3S9F4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3S9F4
Domain Number 1 Region: 5-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.68e-82
Family Capz alpha-1 subunit 0.00000438
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E3S9F4
Sequence length 271
Comment (tr|E3S9F4|E3S9F4_PYRTT) Uncharacterized protein {ECO:0000313|EMBL:EFQ85395.1} KW=Complete proteome; Reference proteome OX=861557 OS=(Drechslera teres f. teres). GN=PTT_19663 OC=Pleosporaceae; Pyrenophora.
Sequence
MPRTTALSSFISSAPPGELTEVTKAIKSILGDDSVANELSPAFQKYNEEQFTTTKLPGGA
TEVLVSEYNALGDGRYYDIDTQSSFDFDHATGKASAVQSYVLESEQGDLVKSLNKALTTH
VSEHYPRSSHGVYPVPSSPSSLAILTVANKYSPTNYWNGRWRSSYIYDTTSGSITGAIKV
DVHYYEDGNVRLLTTKEVNVSVGAGAGAAEVMRKIAAEEKKYQEDLNKAFASLSEGAFKA
LRRQLPITRQKIEWEKISGYRLGQDIGGGRK
Download sequence
Identical sequences E3S9F4
EFQ85395 XP_003306509.1.2082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]