SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E4L0F2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E4L0F2
Domain Number - Region: 5-43
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0123
Family Capz beta-1 subunit 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E4L0F2
Sequence length 47
Comment (tr|E4L0F2|E4L0F2_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EFR32418.1} KW=Complete proteome; Reference proteome OX=908338 OS=Peptoniphilus harei ACS-146-V-Sch2b. GN=HMPREF9286_0795 OC=Peptoniphilus.
Sequence
MPKKDQKQKEAKMLIEEYQPQSVQDIQEALKDLLGDTMEELLKAELD
Download sequence
Identical sequences E4L0F2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]