SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E4V4C2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4V4C2
Domain Number 1 Region: 4-268
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.8e-75
Family Capz alpha-1 subunit 0.00000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E4V4C2
Sequence length 276
Comment (tr|E4V4C2|E4V4C2_ARTGP) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EFR04846.1} KW=Complete proteome; Reference proteome OX=535722 OS=gypseum). GN=MGYG_07850 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Nannizzia.
Sequence
MPSQAEIASSFIEGAPPGEILTDSVLTTDIKALTSGSNLIPSLEPAFRKYNEAQLATVKL
AGSSREVIVSAYNKLEDGRYFDVESQTSFDFDHVSQTASNPRSYVLESQNADLIKSYLKL
ISSHAREHYPNSSYGVYPSQDDSSIAILLVANKYSPNNFWNGRYRAIYNVPATSAGTITG
NIHVDVHYYEDGNVSLNNQKPVSISIPSASPADAAFKRIVAAEREHQEELNDAFNRLSEG
AFKGLRRQLPITRQKVEWEKIGAYRLGKDISGGTGY
Download sequence
Identical sequences E4V4C2
XP_003169681.1.68176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]