SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E4WRQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4WRQ6
Domain Number 1 Region: 5-260
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.35e-84
Family Capz beta-1 subunit 0.0000000098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E4WRQ6
Sequence length 269
Comment (tr|E4WRQ6|E4WRQ6_OIKDI) Uncharacterized protein {ECO:0000313|EMBL:CBY20438.1} KW=Complete proteome; Reference proteome OX=34765 OS=Oikopleura dioica (Tunicate). GN=GSOID_T00000433001 OC=Oikopleura.
Sequence
MANLDQQLDGALDMMRRLPPHHVQRNLSNLIDLVPDLCDDLLAAVDQPLKVGKDKKTGQD
YLFCDYNRDGDSYRSPHTNEYDPPIDDGAVPSDYLRKLEIEMNSAFNQYRELYFDGGVSS
VYLWDLDHGFAGVILIKKATEKAPKGCWDSIHVFECQEKSRSAHYKLTSTVMLWLQTNTK
GAGMMNLGGSLMRQLERDMPLDAGSPHVINFGKLVEEHENKIRHTLNEIYFGKSRDIVHG
LRSIQPLQDEKAKKALADELNRKLNKLPS
Download sequence
Identical sequences E4WRQ6
GSOIDT00000433001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]