SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E4X8R1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E4X8R1
Domain Number - Region: 206-325
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0126
Family Capz alpha-1 subunit 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E4X8R1
Sequence length 360
Comment (tr|E4X8R1|E4X8R1_OIKDI) Uncharacterized protein {ECO:0000313|EMBL:CBY08197.1} KW=Complete proteome; Reference proteome OX=34765 OS=Oikopleura dioica (Tunicate). GN=GSOID_T00004210001 OC=Oikopleura.
Sequence
MGCGASKEVVEEEIKEERRREKHNGLDIHLNVPIETPKEVPAPPLPPQEPLKIIVEQPIH
QPPPPVVQPPHVPEQLLQQPSIQQQQPAQQLEPQYNPVPSTMGVSLEDLSDKICLIEQNI
QLQIKLKTQKEPKKAIAANQSRAEQNQLAALPPAQPQLAIQAPPPPQQPQIVQVSVPYQV
PVPYQIPVTPHKTNPGFDNAMMPSSQTDNMTSAVLEQHLAKLKREQDLLIRDLNRIKRHG
HYDPNSFKVRSILSYIENQQKAINQLESAVSAASFAENDFTDFSFPNYSQPAAQHTIRPQ
TMNYKANSGHWNANAALPPVGNTQGPYGSMYSQQGNPNVQRMEIKTPQNPHQNLGYPGFY
Download sequence
Identical sequences E4X8R1
GSOIDT00004210001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]