SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E4Z434 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E4Z434
Domain Number - Region: 24-97
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0654
Family Capz alpha-1 subunit 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E4Z434
Sequence length 160
Comment (tr|E4Z434|E4Z434_OIKDI) Uncharacterized protein {ECO:0000313|EMBL:CBY42462.1} OX=34765 OS=Oikopleura dioica (Tunicate). GN=GSOID_T00026157001 OC=Oikopleura.
Sequence
MQQSILEKIAKLLCCATNLPERQENTIEDKREIRYDYDPKPEPQIPWNQIPSVVLDDGSC
TSLHTKHNDNGNQYVPVSNSNETLESSTDGVFDIYQNPPSTEEQRARLREEHRFKNQSKI
KLHREKSISMTNLSAPKANKFPPTSNLMLIKSKSQFDILT
Download sequence
Identical sequences E4Z434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]