SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E5FJ31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E5FJ31
Domain Number - Region: 146-193
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0523
Family Capz beta-1 subunit 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E5FJ31
Sequence length 217
Comment (tr|E5FJ31|E5FJ31_9CAUD) Holin {ECO:0000256|HAMAP-Rule:MF_04104} KW=Complete proteome; Reference proteome OX=700939 OS=Escherichia phage vB_EcoM_VR7. GN=VR7_gp267 OC=Tevenvirinae; Sp18virus.
Sequence
MEPKVGISIPDLLFGLLDRIFKDNATGKVVFSRVLVIVLLFLMAVIWYKGDAILDAYRDA
SYASYTEMIRQDQDNRFKIAAIEQIQIVHSSSGADFTAIYSFRPTNLNYFVDMVGYEGIL
PESVDEKNLGGFPIDKTSAEYLAGVNGNYFESGTESVFLPTKKKSSFAYMFSCPFFNLEN
VYAGTVSLYWYKQKPDLGFDRLSAMCGQAGRTLGRTR
Download sequence
Identical sequences E5FJ31
YP_004063948.1.52196 gi|314121829|ref|YP_004063948.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]