SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6LBF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6LBF3
Domain Number 1 Region: 86-299
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 6.59e-44
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.00058
Further Details:      
 
Weak hits

Sequence:  E6LBF3
Domain Number - Region: 55-83
Classification Level Classification E-value
Superfamily Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor 0.00471
Family Iron-sulfur subunit of formate dehydrogenase N, transmembrane anchor 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E6LBF3
Sequence length 305
Comment (tr|E6LBF3|E6LBF3_CAMUP) Formate dehydrogenase {ECO:0000313|EMBL:EFU71174.1} KW=Complete proteome OX=888826 OS=Campylobacter upsaliensis JV21. GN=HMPREF9400_1398 OC=Campylobacteraceae; Campylobacter.
Sequence
MKKLFLLVLSFANLFAYGEERMGQDTQIWDYNRITNIANYDTFGKLWTTLQGEYIATVAL
LSVIAVLAAFALHYMVIGPKQFSHAGKKIYAFSLFERLFHFIAALSWVILVPTGFIMMFG
TTFGGGLFVRVCKNLHAIATILFIVSIIPMFFWWIKRMLPASYDIKWLMIVGGYLSKKKK
PVPAGKFNFGQKSWYYIAVFGGFLMIITGGFMYFLDFNSTPVQSIFGLSHIELLRLSAII
HNLLGIVCAVFFGVHIYMAVFAIKGSIHSMVSGYKEEEEVYILHSYWYKELSKKKQIEPS
FSYEH
Download sequence
Identical sequences E6LBF3
WP_004277940.1.43247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]