SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E6QZ74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6QZ74
Domain Number 1 Region: 4-146,309-444
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.19e-76
Family Capz alpha-1 subunit 0.0000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E6QZ74
Sequence length 452
Comment (tr|E6QZ74|E6QZ74_CRYGW) F-actin capping, putative {ECO:0000313|EMBL:ADV19399.1} KW=Complete proteome; Reference proteome OX=367775 OS=(Filobasidiella gattii) (Cryptococcus bacillisporus). GN=CGB_A1430W OC=Cryptococcus gattii species complex.
Sequence
MVGLSVEDKCKLAARLVEQTPPGEINDVINDIRAIINDDQALMPHVLPALRSYNLSQLHV
VEHPELSEVPAHTSLLSEAVILPGSESERYVDNIGKNSFAFDHLTFTVSDYQPYELPEEE
EAFRAELAKSLEAYSKNHFPSGFYSVACSQFPLNPQPAAAPITEPEAVIPGGGAPTERAP
EAQDPIPATAEGEASAEPPVEKMDTEEDADFTDVVNELVNSGDLEPSSTPAVGDVGIKED
ITDPEHLEELDEAVEEEKEREEEEEREMGEGNAVEKTEPKVEEEDGHKLPQEEEEEIEKK
VEGLKMDKKQEKIENPVYTLEVVGNRYNPSNFWTGRWRTRWVVDQTAGKVNGTIQVDVHY
YEQGNVQLATKHTASFPYPTEPNGSQSIASQIVTTISKIETNYHLELNDVYSELGEKAFR
ALRRALPVTRQKMDWDKVTGYTLGADLSKARA
Download sequence
Identical sequences A0A0D0YB46 E6QZ74
XP_003191186.1.73883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]