SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6W1B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E6W1B8
Domain Number - Region: 17-37
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00837
Family Integrin beta tail domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E6W1B8
Sequence length 63
Comment (tr|E6W1B8|E6W1B8_DESIS) Uncharacterized protein {ECO:0000313|EMBL:ADU65374.1} KW=Complete proteome; Reference proteome OX=653733 OS=Desulfurispirillum indicum (strain ATCC BAA-1389 / S5). GN=Selin_0626 OC=Desulfurispirillum.
Sequence
MDCKPNTKDCACSYPGCPRHGRCCECVAYHRGKNQVTACFFSPAAERTYDRSIANLARDK
GLL
Download sequence
Identical sequences E6W1B8
WP_013505262.1.92402 gi|317050814|ref|YP_004111930.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]