SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E6ZF12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6ZF12
Domain Number 1 Region: 7-280
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.55e-114
Family Capz alpha-1 subunit 0.000000000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E6ZF12
Sequence length 285
Comment (tr|E6ZF12|E6ZF12_DICLA) F-actin-capping protein subunit alpha-1 {ECO:0000313|EMBL:CBN80762.1} OX=13489 OS=Dicentrarchus labrax (European seabass) (Morone labrax). GN=DLA_It01870 OC=Eupercaria; Moronidae; Dicentrarchus.
Sequence
MADFEELSDEEKVRIAANFVMHSPPGEFNEVFNDVRILLNNDNLLREGAAHGFAQYNMDQ
FTLAKIQGYEDQVLITEHGDLGNGRFFDPHNKISFKFDHLRKEASDPQPHEGEAALRSWR
DACDSALRAYVKEHYPSGVCTVYGKTIDGQKTIIACIEGHQFEPKNFWNGRCRSEWKFSV
SQSTAQVVGVMKIQVHYYEDGNVQLVSHKDVQEALTVSNESQTAKELVKIIEDAENEYQV
AISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences E6ZF12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]