SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7BQ86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7BQ86
Domain Number 1 Region: 85-138
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.00000000000000275
Family E6 C-terminal domain-like 0.0021
Further Details:      
 
Domain Number 2 Region: 5-66
Classification Level Classification E-value
Superfamily E6 C-terminal domain-like 0.00000000000000405
Family E6 C-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E7BQ86
Sequence length 141
Comment (tr|E7BQ86|E7BQ86_9PAPI) Protein E6 {ECO:0000256|HAMAP-Rule:MF_04006, ECO:0000256|RuleBase:RU363123, ECO:0000256|SAAS:SAAS01013181} KW=Complete proteome OX=909330 OS=Human papillomavirus type 131. GN=E6 OC=Gammapapillomavirus.
Sequence
MASTYPNNLVDLCSACNISFFNLHLDCLFCKHKLTILDLAGFHQKQLSVVWRNDKAFGSC
SKCLRLTANYERENYYRCSVKGSLISGLLKTPLKDITVRCLYCFQLLDLIEKTQHHLGDR
DFHLVRNHWRGCCRNCYSYEG
Download sequence
Identical sequences E7BQ86
YP_004169277.1.10501 gi|319976672|ref|YP_004169277.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]