SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7G758 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7G758
Domain Number 1 Region: 69-140
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0000000129
Family Sigma4 domain 0.04
Further Details:      
 
Weak hits

Sequence:  E7G758
Domain Number - Region: 13-94
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.0249
Family Clostridium neurotoxins, "coiled-coil" domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E7G758
Sequence length 166
Comment (tr|E7G758|E7G758_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EFW06136.1} KW=Complete proteome; Reference proteome OX=469596 OS=Coprobacillus sp. 29_1. GN=HMPREF9488_00596 OC=Erysipelotrichaceae; Coprobacillus.
Sequence
MGFNYQKELIKWNQWKKQEEELLKALNVDDNIIKQLYDYDWEMFKTERRIRGRQDTTINT
VLNNIPYYDKKEINTIDDLLSEIENEALFNYLSTIDKETLTIILLKIFGYSTHEISEILS
LSHSSIYKKIHRLRKKLKNFKKVSKISCSNCLYSEGVKKDLLYIAL
Download sequence
Identical sequences E7G758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]