SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E7NK35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7NK35
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.22e-81
Family Capz alpha-1 subunit 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E7NK35
Sequence length 268
Comment (tr|E7NK35|E7NK35_YEASO) Cap1p {ECO:0000313|EMBL:EGA61454.1} KW=Complete proteome; Reference proteome OX=764101 OS=Saccharomyces cerevisiae (strain FostersO) (Baker's yeast). GN=FOSTERSO_2895 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSSSKFEEVINKIINDSPPGELREVYDDLIKITSENSKNTXLDAIXNYNVXNCIPIEVNG
NSVIISKYNKEGAKFFDPVNSVIFSVNHLERKGLDIEPYEFTHAKIEKGQLKELHDKLHE
YLLQSFPGDVSFAVYPVPEEISKISIIIVSTKYNPNNFWNGHWRSSYIYDLETRELSGQI
STQVHYYEDGNVSFQSGKDINQSNVDDVVCTIRDIETNFENDLDLSFFDLNEKQFKALRR
RLPVTRSKINWGSAIGSYRLGKNAAEGK
Download sequence
Identical sequences E7NK35

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]