SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E8WUR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E8WUR9
Domain Number - Region: 18-57
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0301
Family Apolipoprotein A-I 0.026
Further Details:      
 
Domain Number - Region: 95-120
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0889
Family Preprotein translocase SecE subunit 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E8WUR9
Sequence length 124
Comment (tr|E8WUR9|E8WUR9_GEOS8) Uncharacterized protein {ECO:0000313|EMBL:ADW14387.1} KW=Complete proteome; Reference proteome OX=443143 OS=Geobacter sp. (strain M18). GN=GM18_2943 OC=Geobacteraceae; Geobacter.
Sequence
MGERTTTPSGLSASEELLARTFDHWREEFRSILESHRREIQDRLEKIEREIEKKSDKENV
EVLVRSIYSDLHRHAEEIDRLHARVGSKMGTETMWKIVGLVLTIGSTIGGLVGFLIHLLL
KVNP
Download sequence
Identical sequences A0A0B5FQ67 A0A1M5XHP0 E8WUR9
WP_015721232.1.3633 WP_015721232.1.58079 WP_015721232.1.71198 WP_015721232.1.72676 WP_015721232.1.96047 gi|322420440|ref|YP_004199663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]