SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E9E2P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9E2P4
Domain Number 1 Region: 5-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.97e-84
Family Capz beta-1 subunit 0.0000000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9E2P4
Sequence length 283
Comment (tr|E9E2P4|E9E2P4_METAQ) F-actin capping protein beta subunit {ECO:0000313|EMBL:EFY89710.1} KW=Complete proteome; Reference proteome OX=655827 OS=Metarhizium acridum (strain CQMa 102). GN=MAC_04142 OC=Metarhizium.
Sequence
MAEIDPFDSALDLLRRLNPKHTASHLNAIISLAPDLTEDLLSSVDQPLTVRRCKQSGREY
LLCDYNRDGDSYRSPWSNQFDPPLDEAGAGGVGADGNEGAGEGAIPSERVRKMEMKANEA
FDIYRDLYYEGGVSSVYFWNLDDGFAGVVLLKKSATPGGTTEGVWDSIHVFEAIERGRTT
HYKLTSTVILSLATADGSLGDMDLSGNMTRQVEQDLPVDSDDSHIANVGRLVEDMELKMR
NLLQEVYFGKAKDVVGDLRSVGSLSDGARDREAQKELIGSMRR
Download sequence
Identical sequences E9E2P4
XP_007810482.1.36369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]