SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E9EQW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9EQW0
Domain Number 1 Region: 7-251
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.16e-77
Family Capz alpha-1 subunit 0.0000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9EQW0
Sequence length 263
Comment (tr|E9EQW0|E9EQW0_METRA) 2-oxoisovalerate dehydrogenase beta subunit {ECO:0000313|EMBL:EFZ02616.2} KW=Complete proteome; Reference proteome OX=655844 OS=anisopliae (strain ARSEF 23)). GN=MAA_02198 OC=Metarhizium.
Sequence
MSQVETLADVIADIKALTVSSPDIVSELTPAFEKYNEEQLVTVKLPGSSQPVVISSHNAL
GDGRYYDVESSSSFAVDHATQAPSAVKTHMIEGPQVDLVTSTLKSLSAYVKEHFPNASYG
AYPIESDSKVAIIIVANKYSPNNFWNGRWRSQYVFDPASGSLEGSIKVDVHYYEDGNVRL
LTNKPVTASITSRTGAGIAKEISATERKYQEELNKGFVNLSENAFKSLRRQLPVTRQKIA
WDKVMTYRLGQDIGGGNSKGSSI
Download sequence
Identical sequences E9EQW0
XP_007818387.2.8330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]