SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9GF46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9GF46
Domain Number 1 Region: 155-276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-24
Family MAM domain 0.0051
Further Details:      
 
Domain Number 2 Region: 55-103
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000528
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 87-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000153
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Weak hits

Sequence:  E9GF46
Domain Number - Region: 309-356
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000183
Family Somatomedin B domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9GF46
Sequence length 368
Comment (tr|E9GF46|E9GF46_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX81961.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_317166 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MAARRNWKCPTLLLITLILWLNAAHCQQTGGNNSRKRDTCPKVVLKNGKIKLRSGGRVVK
YSCNRDYVLVGESTSTCLQGEWTSEAPVCATKGCPYIPSPPSGRFIASNGGAVMRLECNP
GYRPSGSPMIYCVDKFDWNGTAPLCQASGVQQSATRCDFESDDLCGWVQDTRTDEFDWTW
QNYGTPSFHLGTGPSFDHTLGQGKAGQINVYIKPESKKMSELRPAFVRSGDQGDRWRQGY
ISLDTVTENFQVVIEGVRGTGYVGDSAIDDVQLTKGEECLAALKRMMADTIVPGGSTTPP
SSTIPPNASCSTRCSTSERTEEPANTNTSSSWTCGCSDDCLLKNSCCSDYAAFCLTGESC
PSAIVYDH
Download sequence
Identical sequences E9GF46
jgi|Dappu1|317166|NCBI_GNO_1900165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]