SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E9HXC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E9HXC3
Domain Number - Region: 74-139
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0863
Family Capz alpha-1 subunit 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E9HXC3
Sequence length 1879
Comment (tr|E9HXC3|E9HXC3_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX63608.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_119070 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MKDSQSISSASTAKNSTGLPGLPDCFSDSESSPSPLGASADSVMGSTPVGELIQIPESDL
ELNESESQRDFIANSVMEDQANQVSKEIDTVEQMCLDMQQTHEDQENDKKRRQFQASIWQ
HLGKYVLISYKDETYTSVGRLEKIEQDKDSNMKITLRTYRARHGKAFTISDEELKSIETF
DEEDPDVVESLIKGEGTDVRITTTDAETIIGLITDIDKDEHNKLVHLLIMDKETERLTTR
VERMKDIFKVEPTKEPENKMNLKRRLNQQTIIRFIIENTEREERGKPAGFHTILGEDHVM
LKTEHAGGVTVVIPLHNIEQILTDPEDDESDEETLKAEESTTDHNTESSESDMDKQDSQT
EPEQSSRDTPNGGKRTSNKWKHPKRPKWDPEEQTETYAERARKATRPKEVTFQWTKMPLT
NKTVRRRDLKQDWITAFKKAIQEEQHKAQKSSEWVDYSEQYIKALADVGIRVPLEVMKFT
RVTIDEDTINKPDDLNELWELAQQKAKPKEEVLEQRRWENLLKSEFDHEIDTAVRQNVEP
DYRYAMTRAFVKMGHEVEPKWFSTLQITQDLTKSYRMREEVWDIAKRNLAYEDHIKKENR
QMKPAWLLLLKEAIEYEKTRAIRFDTNIDYRAAILISLSRTGRLITPERLAGLEIYTDKD
MENEQTLDDIWERANLELDYQMITAKKGTRGPQKMDKKTLWSKKIMEHLYNLLTSTNTGN
WSVDHGLIAERAFQDIGWNLNKCQFRHKFTAKNMVDRFLMLNRVNQNHIWHLACEIINDQ
KGDNNGDLPPQMLRQTWETTLGYKVHEYRIRKQYRLNKENEEHHLTPAVSAFEAIGWNVP
HSALSWLYTNDAQDLLGDYTKRLLWYSGCSHQKKPREFYITSSIGMKPPKIEMDNGVVKY
TELPTTFDDKVDKLQINHDYQQHMEKHQLSFDDWMERSNLNRLINMGDEPYEIDDPWILK
TLTEIGHRDFFIANWMMDYMSTKLNFDMWYNFIGKELKIPQDLKSQLEEDKEEDKKSKWD
LEHEWKVAGTPELLDRFQIKKESKETQTEDHKLTICSLQAPYRPMTAIKEEHGEEKPSMD
QSHFTNEPLFIALSGEPLDKQQRKTLYEAMEQEMANTIREEAAEKAKAEITNKEYESTII
TMGIRLPPMNRNVWRLETMLANNILHMQVLMTDIYPEHFAPKGVLAHVHIPTYVYIPNAV
FKEYGITIKENTTSYVTFWQRLQEAQWQSTELIEPEHLRSTYKTSYRKLLRNQAPKTVAT
GKREITQHHFAQMEARRIGWHKLSDEDIYDWFIRPVERYFAIDMPLGSLLLRAMSYPQSA
DKLVSVIKRYTGIPKQALTNVEAVITELSKIRLSYEQDFIRKEGKETPIARMPPVQLTKS
GEGCTYMHNDEVLHTKQYEKDTQEDDSDFTTGEDSERLGTWNSIMSQHTKQIVEQLRKEP
TNPQGLRHILRKAQLETMKSLTKCKVECKKANCMKPQTEHAKKQNKENVLGARRKTAKPP
GVKTAKKTHVRPTAWPTVKQIREGNPYKQKVQASPTTPHQRFTGEPQRTPPFTTRGRNPG
YNANFTTDYLQASPENHKKFQRYDPNLSQVNTPSSESFNSEVTSTSTPAVQRRYFGKTEP
MPIPSPTRRPEHHMHPGAIPKQTGTRTRGQDPSPPPPGGNTKTIRDMAPNRQPLFHYRFY
DPKSKTPPDFTKLQLSAAQVKEYLRGLTDTRDCSNEGYAKVIAYGIESYHAITIHSLEEE
TFRVITIEDRKIPRDRTKTITEECVYIPEYAMEDFDNLLQAVHLEVMQPMQYDQGYKGNL
LLLRAATADWKAKATIHTTETIRGTERTVTIVVRYKNEARFIQIPWLTFSKLVEAYQKVR
EDYQKLRKRIQQEKANQRQ
Download sequence
Identical sequences E9HXC3
jgi|Dappu1|119070|fgenesh1_pg.C_scaffold_584000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]