SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for E9I828 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9I828
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0000000000000183
Family Capz alpha-1 subunit 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E9I828
Sequence length 131
Comment (tr|E9I828|E9I828_DAPPU) Uncharacterized protein {ECO:0000313|EMBL:EFX59852.1} KW=Complete proteome; Reference proteome OX=6669 OS=Daphnia pulex (Water flea). GN=DAPPUDRAFT_346791 OC=Diplostraca; Cladocera; Anomopoda; Daphniidae; Daphnia.
Sequence
MSEDHEKIQKYIIKSTPYGELSEVLRDLERLAPLNAHSPAISQAVEDYNEDHLALIPLKS
PLQSYFPLMTCSKVGAGRYLDQANKKIYTIDHLKGEVISVEDTTVELVDSVEELLSHLSQ
AAAKYTEKYYK
Download sequence
Identical sequences E9I828
jgi|Dappu1|346791|NCBI_GNO_1529700002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]