SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E9N646 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E9N646
Domain Number 1 Region: 11-168
Classification Level Classification E-value
Superfamily EspA/CesA-like 4.71e-58
Family EspA-like 0.0000000571
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E9N646
Sequence length 171
Comment (tr|E9N646|E9N646_ECOLX) EspA {ECO:0000313|EMBL:ADU60569.1} OX=562 OS=Escherichia coli. GN=espA OC=Enterobacteriaceae; Escherichia.
Sequence
YDLGSMSKDDVIDLFNKLGVFQAAILMFAYMYQAQSDLSIAKFADMNEASKESTTAQKMA
NLVDAKIADVQSSSDKNAKAQLPDEVISYINDPRNDITISGIDNINAQLGAGDLQTVKAA
ISAKANNLTTTVNNSQLEIQQMSNTLNLLTSARSDMQSLQYRTISGISLGK
Download sequence
Identical sequences E9N646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]