SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0SBP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F0SBP1
Domain Number - Region: 26-106
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0366
Family Capz alpha-1 subunit 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F0SBP1
Sequence length 110
Comment (tr|F0SBP1|F0SBP1_PSESL) Uncharacterized protein {ECO:0000313|EMBL:ADY52732.1} KW=Complete proteome; Reference proteome OX=762903 OS=LMG 10337 / NBRC 100064 / NCIMB 13643) (Pedobacter saltans). GN=Pedsa_2180 OC=Sphingobacteriaceae; Pseudopedobacter.
Sequence
MDNLKHHRKGFDTMVEALNDLAARGYSGNLKLREHYLEEEEKQLMLYPEHFKVVETYRFE
GMSDPEDNSIIYAIESLDGTFKGVLVNAYGAYAERASSDMIRALEIDHYH
Download sequence
Identical sequences F0SBP1
gi|325104900|ref|YP_004274554.1| WP_013633218.1.90845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]