SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0UL70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0UL70
Domain Number 1 Region: 3-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.05e-87
Family Capz beta-1 subunit 0.000000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F0UL70
Sequence length 266
Comment (tr|F0UL70|F0UL70_AJEC8) F-actin-capping protein subunit beta {ECO:0000313|EMBL:EGC46174.1} KW=Complete proteome; Reference proteome OX=544711 OS=(Histoplasma capsulatum). GN=HCEG_05389 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Histoplasma.
Sequence
MADTQFDSALDLLRRLSPRETKQNLEYITSLVPDLTEDLLASVDQPLEIRRCAQTKRDYL
LCDYNRDGDSYRSPWSNEFDPPIEDGTVPSERVRKLEVAANEAFDVYRELYYEGGVGSVY
FWDLDDGFAGVVLLKKAITPGSKNSGAWDSIHVFEATDRARTCHYKLTSTVILHLSTGSE
GLGELDLSGNMTRQIEADMAVDGDASHVANVGRLVEDMELKMRNLLQEVYFGKAKDIVSD
LRSIPPLSETNRDQATHREMINSMKR
Download sequence
Identical sequences A6R544 C6HAA7 F0UL70
HCAG_04752T0 XP_001540912.1.38663 HCDG_03138T0 HCEG_05389T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]