SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0UU22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0UU22
Domain Number 1 Region: 4-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.03e-85
Family Capz alpha-1 subunit 0.00000573
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F0UU22
Sequence length 274
Comment (tr|F0UU22|F0UU22_AJEC8) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:EGC49399.1} KW=Complete proteome; Reference proteome OX=544711 OS=(Histoplasma capsulatum). GN=HCEG_08614 OC=Eurotiomycetidae; Onygenales; Ajellomycetaceae; Histoplasma.
Sequence
MPSNLEIASSFIRGAPPGELSDVVADIKALTPEGPALISSLAPAFEKYNEEQLATVKLPG
GSEEVIVSSYNKLDSNRYYDVQTQTSFQFDHVTQTASSPQSYVLESRHSDLIKSLLKSLS
AHAREHYPSCSYGVYPTDDDSTVAILLVANKYSPNNFWNGRYRAIYTVPAPSTDTITGTI
HINVHYYEDGNVSLNTTKPISISLPVNSSADTVIKRIAAAERAQQLELSDAFSRLSEGAF
KGLRRQLPITRQKVEWEKVGGYRLGQDISGGKGR
Download sequence
Identical sequences C6HD97 F0UU22
HCEG_08614T0 HCDG_04178T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]