SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0YJQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0YJQ7
Domain Number 1 Region: 7-272
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.7e-60
Family Capz alpha-1 subunit 0.0000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F0YJQ7
Sequence length 272
Comment (tr|F0YJQ7|F0YJQ7_AURAN) Uncharacterized protein {ECO:0000313|EMBL:EGB04700.1} KW=Complete proteome; Reference proteome OX=44056 OS=Aureococcus anophagefferens (Harmful bloom alga). GN=AURANDRAFT_13582 OC=Eukaryota; Stramenopiles; Pelagophyceae; Pelagomonadales; Aureococcus.
Sequence
EEEEQASPEEKLQIVQHLLLSSPPGEFDDVLSDAMALVPGDLVSRPMLAGIARAYNNANL
RCARAADGTLVLLSERGELEPTLYARPPTGRRAGVDHVALTAEAEAGGGPAAPGAFAAER
DAVAAAVGAYVGARYGAECKCGAVYESDDASELAVVISGESVNLRNFWSGNWRSEWTVVL
GDGEALVSGAVKVRAHYFEDGNVQLQTSKTCGEATVAAASPADLGAAVAAFVEAAETDLQ
NGLQEMYDNMSAETFKAMRRVMPITRTKMKWN
Download sequence
Identical sequences F0YJQ7
jgi|Auran1|13582 XP_009040614.1.21850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]