SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0ZDF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0ZDF8
Domain Number 1 Region: 536-630
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.85e-18
Family Cold shock DNA-binding domain-like 0.0068
Further Details:      
 
Domain Number 2 Region: 251-351
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000134
Family Cold shock DNA-binding domain-like 0.0054
Further Details:      
 
Domain Number 3 Region: 629-706
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000283
Family Cold shock DNA-binding domain-like 0.015
Further Details:      
 
Domain Number 4 Region: 351-436
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000119
Family Cold shock DNA-binding domain-like 0.016
Further Details:      
 
Weak hits

Sequence:  F0ZDF8
Domain Number - Region: 150-194,221-242
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000129
Family Cold shock DNA-binding domain-like 0.03
Further Details:      
 
Domain Number - Region: 52-175
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.068
Family Capz alpha-1 subunit 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F0ZDF8
Sequence length 812
Comment (tr|F0ZDF8|F0ZDF8_DICPU) Uncharacterized protein {ECO:0000313|EMBL:EGC38037.1} KW=Complete proteome; Reference proteome OX=5786 OS=Dictyostelium purpureum (Slime mold). GN=DICPUDRAFT_29294 OC=Dictyosteliaceae; Dictyostelium.
Sequence
MTDFVRGKNQHKIISEKKDDDELVSTKRLNPKRSNFSDKNNSIKKKQKTSKTTSAIIKDE
DEIVSSDNENENTTVSIEEEKDRNLFSSVYHTLKNKKKSKLTNKIEKLTPTQLKEYLNEP
SNVLNKKEEADAKKLLPFLKKNIPKSACRLFKKDIHKGMVVLGSFESVSEIDITISLPFG
LKGYIKFNEISDSFTEWMKKTLEREEENVKSTNFRKMKIISDQVRKMFYKGQIIKVAIAG
FTDHHTIEGLHCSMRPEVVNSGSSMETFTENMTIHGAVQSIEDKGYIVSFGSKDYTGFIE
FSNTNYYYPGQTDEKQNDLFVGQPIEALIDSIDKDTKTFKLTLSHSLVSRATVKDSSVIT
MDSIKAGMLVETKVIAVIGGGLHLGFLDFFAGDVELLHLNNPLDNYKDNQNVKARIIFVD
QVNKRIGLSTLPHIMGYKPYPFGTFKKGQIFDFNSLTVERIEPLEMILACPSTVVSSKPQ
TIKGYVHIEELESGVVNLNKASNQFKKGEAFNKKCRIKHLDYLDGMVTFTARTRELEKKF
FSYNDIECGMITTGIIKYIREESVEIELAPSIHGVVPKTHLADVAITNTSTFFKLGSTVK
VRVISVDPDKKRLQLTLKKSLIQSEYPIITDKNTTPAGLISHGIITKTTRYLVFVSFYNN
SFGVVESQNLSLTPIQSVQKQFPIGRTVLVKSLSSDNSKPGLSLTMIIDDKDFESQQKIL
INNNLNNKQVDQQEEEEQEEQEEEQQEEQVEEEQQEEVEQEEQEEEKVAEEKVKKVEPKN
KKDKQNTNNKKVEKSKVNNVKSTPKPKTNKKK
Download sequence
Identical sequences F0ZDF8
XP_003285438.1.95606 jgi|Dicpu1|29294|e_gw1.45.30.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]