SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0ZDQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F0ZDQ1
Domain Number - Region: 83-203
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0194
Family Capz alpha-1 subunit 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F0ZDQ1
Sequence length 220
Comment (tr|F0ZDQ1|F0ZDQ1_DICPU) Uncharacterized protein {ECO:0000313|EMBL:EGC37974.1} KW=Complete proteome; Reference proteome OX=5786 OS=Dictyostelium purpureum (Slime mold). GN=DICPUDRAFT_76470 OC=Dictyosteliaceae; Dictyostelium.
Sequence
MDEDLYINGRSVNTLRHYEIKKILARKGAQMERCPRKRPLYNRLVEILKKTGNENKIENK
IKDTIETTSATIGEVIETTTTNRTLEKPYPSGNKILGSYSKKYNSNNHTPTRPVLNSSEL
TGPNNSSYDNNSKQLSVQNFNKIKAEVSIKEKRNSEIEKEEFEPEVESNQLEKKNYQENY
NNNNTTIININNNNDQLKTLIIILLLFFIMFIMILIDNEK
Download sequence
Identical sequences F0ZDQ1
jgi|Dicpu1|76470|fgeneshDP_pg.C_scaffold_47000044 XP_003285545.1.95606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]