SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0ZIU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0ZIU9
Domain Number 1 Region: 2-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.63e-84
Family Capz alpha-1 subunit 0.00000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F0ZIU9
Sequence length 281
Comment (tr|F0ZIU9|F0ZIU9_DICPU) Uncharacterized protein {ECO:0000313|EMBL:EGC36153.1} KW=Complete proteome; Reference proteome OX=5786 OS=Dictyostelium purpureum (Slime mold). GN=DICPUDRAFT_97675 OC=Dictyosteliaceae; Dictyostelium.
Sequence
MASKEELVQIATNFLLNAPPCEFMEVVSDVRALLPNESLLNATAADTFREYNTTQMISVS
TSKGQTLITKEGEVSANEYLDPKNKQVVSFDHIKQAVTGERSASGEIEQDIESIRSAFEE
EAVKYCNEFYPNGVCAVYGNKVSEGTRITICISAALYNPNNYYSGRWRSTWVCTIAGSNV
TSNGKIQINVHYYEDGNVQLNTITQKSCTSAAGDAKSTAVNALKAIGKVELNLHSSIDTS
YSTMGDTTFKALRRALPINRSKINWQKVRGFKVGAELNQAK
Download sequence
Identical sequences F0ZIU9
jgi|Dicpu1|97675|estExt_fgeneshDP_pg.C_960020 XP_003287346.1.95606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]