SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1L4R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1L4R4
Domain Number 1 Region: 2-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.05e-88
Family Capz beta-1 subunit 0.00000000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1L4R4
Sequence length 269
Comment (tr|F1L4R4|F1L4R4_ASCSU) F-actin-capping protein subunit beta isoform 1 and 2 {ECO:0000313|EMBL:ADY45118.1} OX=6253 OS=Ascaris suum (Pig roundworm) (Ascaris lumbricoides). GN= OC=Ascaridoidea; Ascarididae; Ascaris.
Sequence
MSDQQLDCGLDLMRRLPPQQVEKNLNDLIDLCPRLLDDLLSAVDQPLKIARDKDTGKEYL
LCDYNRDGDSYRSPWSNTYDPPLEDGAMPSDKLRKLEIEVNAAFEAYRDAYFEGGVSSVY
FWDLDYGFAGVVLIKKIGDGCRLIQGCWDSIHVIEIQEKAGGRHAHYKLTSTVMLWLQTN
RQGSGMMNLGGSMTRQVEADHPVNDSTNTHLVNMGRMIEDMESKIRSTLNEIYFGKTKQI
VGELRTMLDAEELKRQKMIANEIKGGITK
Download sequence
Identical sequences F1L4R4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]