SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1L8D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1L8D6
Domain Number 1 Region: 8-283
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.1e-90
Family Capz alpha-1 subunit 0.0000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1L8D6
Sequence length 288
Comment (tr|F1L8D6|F1L8D6_ASCSU) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:ADY46390.1} OX=6253 OS=Ascaris suum (Pig roundworm) (Ascaris lumbricoides). GN= OC=Ascaridoidea; Ascarididae; Ascaris.
Sequence
MAADDNQLSDSEKLRIVSGFLLHAPPGEFNEVFNDVRMLLNNDPLLKEGCANAFAQYNKE
QFMPVKLEGVDKPTLITPFNELPNGRFADPKSRKTFKYDHLRKEASDIQSENTSDINMEL
WRKALQEEADKYIDSHYLETGIATVFTYNNAVTLCIESHRYQPKNFWNGRWRSQWTIPVG
GSRSDQQELKGLLKVQVHYYEDGNVQLVSTKEITAKVNVSADYTQTSKDIFKVICEEESK
YEDAVLENYQQMSSTTFKALRRQLPVTGVKFDWNNTHAYRIGKDLKPQ
Download sequence
Identical sequences F1L8D6
GS_01032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]