SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1NHV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1NHV9
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 5.49e-46
Family Eukaryotic RPB5 N-terminal domain 0.00024
Further Details:      
 
Domain Number 2 Region: 135-209
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 2.49e-30
Family RPB5 0.0000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1NHV9
Sequence length 210
Comment (tr|F1NHV9|F1NHV9_CHICK) RNA polymerase II subunit E {ECO:0000313|Ensembl:ENSGALP00000004071} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=POLR2E OC=Phasianidae; Phasianinae; Gallus.
Sequence
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKMYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ
Download sequence
Identical sequences A0A0B8RTW3 A0A1V4KQ69 A0A1W7RDZ6 A0A218UB04 A0A226NU69 B5FX59 F1NHV9 F7BXN9 G3WAN2 J3S511 M7AGU7 T1E533
ENSMODP00000006794 ENSSHAP00000012487 XP_001365263.1.35504 XP_003760879.1.9362 XP_005281100.1.60341 XP_005531245.1.90289 XP_007072138.1.26238 XP_009095148.1.15306 XP_013917707.1.67126 XP_014738420.1.99236 XP_014814063.1.91963 XP_015507277.1.82291 XP_015665493.1.16292 XP_015665494.1.16292 XP_015741843.1.68032 XP_017689873.1.3805 XP_017689874.1.3805 XP_017689876.1.3805 XP_020636759.1.8467 XP_020864572.1.61212 XP_021234168.1.32913 XP_021401857.1.53032 XP_418224.2.86415 ENSMODP00000006794 13616.ENSMODP00000006794 ENSGALP00000004071 ENSSHAP00000012487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]