SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1NQD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1NQD9
Domain Number 1 Region: 199-339
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-44
Family Third domain of FERM 0.000000176
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 5.36e-39
Family Second domain of FERM 0.000000688
Further Details:      
 
Domain Number 3 Region: 496-583
Classification Level Classification E-value
Superfamily Moesin tail domain 3.01e-33
Family Moesin tail domain 0.0000198
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.65e-26
Family First domain of FERM 0.0000064
Further Details:      
 
Weak hits

Sequence:  F1NQD9
Domain Number - Region: 434-477
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0262
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1NQD9
Sequence length 583
Comment (tr|F1NQD9|F1NQD9_CHICK) Radixin {ECO:0000313|Ensembl:ENSGALP00000021028} KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=RDX OC=Phasianidae; Phasianinae; Gallus.
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVRKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQSKYGDYNKEIHKLGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLRQIEEQTMK
AQKELEEQTRRALELDQERKRAKEEAERLEKERRAAEEAKAALAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEASEWQHKAFAAQEDLEKTKEELKSVMSAPPPPPPPPVIP
PTENEHDEHDENNAEASAELSSDGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARD
ETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences F1NQD9
ENSGALP00000027650 9031.ENSGALP00000021028 XP_005014643.1.99704 XP_013817663.1.3284 XP_015707684.1.68032 XP_015707685.1.68032 XP_015707686.1.68032 XP_021235813.1.32913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]