SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1PV43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PV43
Domain Number 1 Region: 6-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.45e-81
Family Capz alpha-1 subunit 0.0000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1PV43
Sequence length 299
Comment (tr|F1PV43|F1PV43_CANLF) Capping actin protein of muscle Z-line alpha subunit 3 {ECO:0000313|Ensembl:ENSCAFP00000018414} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=CAPZA3 OC=Canis.
Sequence
MSLSVLSRKEKERVIRRLLIQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYS
VPLCIDGNPVLLSHHNVVGDYRFFDYQSKLSFKFDLLQNQLRDIQSHGIIRNETEYLRNV
VLCALKLYVNDHYPTGNCNVLRKSVKNKEFLIACIEDHSYETRDCWNGLWKSKWIFQINP
FLTQVTGRIFVQAHFFRAVNLHIEISKDLKESLEVVNQAQLALNFARLVEEQENIFQAAV
LEELQELSNEALRKILRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII
Download sequence
Identical sequences F1PV43
XP_534875.1.84170 ENSCAFP00000018414 ENSCAFP00000018414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]