SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1Q817 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1Q817
Domain Number 1 Region: 4-269
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.03e-91
Family Eukaryotic proteases 0.00031
Further Details:      
 
Domain Number 2 Region: 292-327
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000902
Family Somatomedin B domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1Q817
Sequence length 328
Comment (tr|F1Q817|F1Q817_DANRE) Serine protease 60.2 {ECO:0000313|Ensembl:ENSDARP00000019814} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=prss60.2 OC=Cyprinidae; Danio.
Sequence
MWRLTCATLTLLICVKGSLSQLNVCGQAPLNSRIVGGVNAPEGSWPWQVSLQSPRYGGHF
CGGSLISSEWVLTAAHCLPGVSESSLVVYLGRRTQQGVNTHETSRNVAKIIVHSSYNSNT
NDNDIALLRLSSAVTFNDYIRPVCLAAQNSVYSAGTSSWITGWGDVQAGVNLPAPGILQE
TMIPVVANDRCNAQLGSGTVTNNMICAGLAKGGKDTCQGDSGGPMVTRLCTVWIQAGITS
WGYGCADPNSPGVYTRVSQYQSWISSKISQNQPGFILFTPPSSCTSSSLTSSSCSGRCNE
VYNTLNRCNCNANCATKCCMDYKQRCAS
Download sequence
Identical sequences F1Q817
ENSDARP00000019814 7955.ENSDARP00000019814 ENSDARP00000019814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]