SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F1QB50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1QB50
Domain Number 1 Region: 3-55
Classification Level Classification E-value
Superfamily LEM domain 4.19e-21
Family LEM domain 0.00037
Further Details:      
 
Domain Number 2 Region: 89-138
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000000249
Family LEM domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1QB50
Sequence length 360
Comment (tr|F1QB50|F1QB50_DANRE) Thymopoietin b {ECO:0000313|Ensembl:ENSDARP00000033049} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=tmpob OC=Cyprinidae; Danio.
Sequence
MAQFHEDPALLTKEKLKSELMANNVALPSADSKKDVYVQLYLKNLTVLNKKNTISAPDTF
SSDEEISTAPLVTNRSRSGKKATRKTDRVRAEENDVSGLTDEELKVQLQKFGIHSGPIVA
STRKVYEKKLQQVLDQPPVETSLPEPETTIPEAVTIKADGNQNGNTHSAEDQYSDKEEEV
PEAPVVTKPVRSRGKTPVTTRTSSRQRTKQVEEMAIEEASVDRADILKEIFPNEQATPTG
ITATCRRPIHGAAGRPVKPLNLCPEESLLEQSLYTVTKSSVTDVYSTVPTARPRPRRRWL
AFLLKLLLLIALVASLYYAYQTVTPDQINACQLYLQDNVITPIVKYISWDSPAEVGGGGK
Download sequence
Identical sequences F1QB50
ENSDARP00000033049 ENSDARP00000033049 7955.ENSDARP00000033049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]